PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g088890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 433aa    MW: 48437.7 Da    PI: 10.0559
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g088890.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B360.13.9e-1970158494
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     +l+++++l+s+ l+lp +f+ ++g++k+   +++l d +g+sWe++++y++ s+r+++t+GW++F+++ g k+g +++F+l+  +++++++
  Csa09g088890.1  70 ALVTASNLESDTLYLPQDFTGSCGLPKKL-CKVVLADGWGNSWELEMRYNQFSNRFYITRGWRHFCDELGKKVGGVFTFELMI-KRGTPFL 158
                     478999******************99866.5*************************************************874.5555555 PP

2B333.67e-11180275398
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE.....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy...rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     +  ++ d+lk++rl+lp   ++++g+ +++   +tl  ++g +   +l     +++ gr  l+k W+eF+ an+L++g  ++++ ++ +++++ +
  Csa09g088890.1 180 TLNLSYDSLKNCRLYLPSVIMRRNGLAETR--LVTLLGKDGTRTIANLVRetsERNFGRLSLGKAWREFALANDLEVGKKFTLECIW-ENATPIL 271
                     55667799*****************99665..7********888877744344555566*************************999.7777877 PP

                     EEE- CS
              B3  95 kvfr 98 
                     ++ +
  Csa09g088890.1 272 RLSD 275
                     7765 PP

3B342.71e-133404241199
                     HHTT-EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  11 lksgrlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                      k ++l+lp +f++++g+++++  +++l  ++g  sW  ++    ++g++  + GWk+F+kang+k g ++ ++++++ + ++v++++ k
  Csa09g088890.1 340 AKACMLYLPSQFMKANGIDTPG--KIVLLGRKGsVSWCGYM---SRDGTVNVGIGWKNFCKANGVKIGASFSLEFKHNVDNTPVLQFRAK 424
                     56799************99766..79999988857888888...5556778899**********************99999999998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.51E-1863158IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.8E-1963157IPR015300DNA-binding pseudobarrel domain
CDDcd100176.93E-1767160No hitNo description
PROSITE profilePS5086313.47967164IPR003340B3 DNA binding domain
SMARTSM010193.4E-1768164IPR003340B3 DNA binding domain
PfamPF023625.9E-1870159IPR003340B3 DNA binding domain
PfamPF023626.1E-10178275IPR003340B3 DNA binding domain
PROSITE profilePS508639.502178277IPR003340B3 DNA binding domain
SMARTSM010193.3E-10178277IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.4E-10178272IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-10181271IPR015300DNA-binding pseudobarrel domain
CDDcd100171.53E-7183275No hitNo description
Gene3DG3DSA:2.40.330.102.3E-13327423IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.08330424IPR003340B3 DNA binding domain
SMARTSM010194.4E-12330425IPR003340B3 DNA binding domain
SuperFamilySSF1019361.73E-14331423IPR015300DNA-binding pseudobarrel domain
PfamPF023624.4E-12341424IPR003340B3 DNA binding domain
CDDcd100179.38E-8343402No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MSVVSACDVR QLPSPRNIDL NKTVNTSEKH QRPAEEGGDV HENEVLERAK RGKTKESIPE  60
AGPDNSSFFA LVTASNLESD TLYLPQDFTG SCGLPKKLCK VVLADGWGNS WELEMRYNQF  120
SNRFYITRGW RHFCDELGKK VGGVFTFELM IKRGTPFLSF SHSKATLCYE TSEDVDNFMT  180
LNLSYDSLKN CRLYLPSVIM RRNGLAETRL VTLLGKDGTR TIANLVRETS ERNFGRLSLG  240
KAWREFALAN DLEVGKKFTL ECIWENATPI LRLSDTKTRK YIKRGPKPKF SGFCKKVSVS  300
NGAKDGKKRD KGKNIEEPIN AASLIEKHRL VILPLVRQDA KACMLYLPSQ FMKANGIDTP  360
GKIVLLGRKG SVSWCGYMSR DGTVNVGIGW KNFCKANGVK IGASFSLEFK HNVDNTPVLQ  420
FRAKPRGINI NV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1305311GKKRDKG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010429455.10.0PREDICTED: B3 domain-containing protein REM-like 2
TrEMBLD7LIB91e-125D7LIB9_ARALL; Putative uncharacterized protein
STRINGscaffold_400529.11e-124(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24696.11e-100B3 family protein